PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003617G0070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SRS
Protein Properties Length: 275aa    MW: 28422.7 Da    PI: 8.4362
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003617G0070genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70262.21.9e-1988124339
           DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathv 39 
                       g++sCqdCGnqakkdC h RCRtCCksrgf C+th+
  PH01003617G0070  88 GGGVSCQDCGNQAKKDCPHLRCRTCCKSRGFTCNTHM 124
                      5789********************************7 PP

2DUF70277.53.6e-24127179101153
           DUF702 101 etsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                       ++++P+evsseavfrcvr++ v+++e+e+aY+t+vsigGhvfkGiL+d G++
  PH01003617G0070 127 VAERFPREVSSEAVFRCVRLGPVEQAEAEVAYRTTVSIGGHVFKGILHDVGPD 179
                      5688***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.1E-1690124IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016237.4E-1892124IPR006510Zinc finger, lateral root primordium type 1
PfamPF051421.8E-21128179IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016248.7E-22130178IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MAGFPLGGGS SRDNPASSVP PVHPSDASSF LYATRGGSFQ LWQQQEQQQQ PFYASNIIRF  60
ADDAPAAPLL AGASSSSRGM RAGGGGGGGG VSCQDCGNQA KKDCPHLRCR TCCKSRGFTC  120
NTHMVTVAER FPREVSSEAV FRCVRLGPVE QAEAEVAYRT TVSIGGHVFK GILHDVGPDA  180
LAAAGGGDYH FRQAGDGSSS STAAAGEAGG RGQYHRVIGC GDGPLPDTRT VRRVPSRHAV  240
LPRPPETVTA ASLSACRCNA TPPSLARSVN CVSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126171e-110CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648772.12e-58PREDICTED: protein SHI RELATED SEQUENCE 1
TrEMBLA3BVH01e-58A3BVH0_ORYSJ; Uncharacterized protein
TrEMBLA2YXT02e-58A2YXT0_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA026532-PA5e-58(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135435124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.14e-28Lateral root primordium (LRP) protein-related